Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Go Science 100 pts. 9,127
  2. Avatar for Gargleblasters 2. Gargleblasters 70 pts. 9,102
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,101
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 9,093
  5. Avatar for Contenders 5. Contenders 19 pts. 9,088
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 9,071
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 7 pts. 9,070
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 9,019
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 8,993
  10. Avatar for Deleted group 10. Deleted group pts. 8,989

  1. Avatar for toshiue 51. toshiue Lv 1 22 pts. 8,986
  2. Avatar for frood66 52. frood66 Lv 1 21 pts. 8,984
  3. Avatar for Mark- 53. Mark- Lv 1 20 pts. 8,975
  4. Avatar for Deleted player 54. Deleted player 19 pts. 8,973
  5. Avatar for georg137 55. georg137 Lv 1 19 pts. 8,970
  6. Avatar for smholst 56. smholst Lv 1 18 pts. 8,965
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 17 pts. 8,960
  8. Avatar for carsonfb 58. carsonfb Lv 1 17 pts. 8,960
  9. Avatar for Mike Lewis 59. Mike Lewis Lv 1 16 pts. 8,957
  10. Avatar for guineapig 60. guineapig Lv 1 16 pts. 8,955

Comments