Placeholder image of a protein
Icon representing a puzzle

1274: Electron Density Reconstruction 1: Round 2

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
August 18, 2016
Expires
Max points
100
Description

This is a followup to Puzzle 1249, with a new density map derived from a Foldit player solution. The solution seems to fit the data, but needs some refinement! Players may load in solutions from Puzzle 1249.



The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 2 pts. 11,349
  2. Avatar for freefolder 12. freefolder 1 pt. 11,305
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 11,216
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 11,151
  5. Avatar for Team Mexico 15. Team Mexico 1 pt. 11,138
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 10,966
  7. Avatar for Herobrine's Army 18. Herobrine's Army 1 pt. 9,610

  1. Avatar for johngran 71. johngran Lv 1 8 pts. 11,462
  2. Avatar for georg137 72. georg137 Lv 1 7 pts. 11,456
  3. Avatar for hpaege 73. hpaege Lv 1 7 pts. 11,453
  4. Avatar for frood66 74. frood66 Lv 1 7 pts. 11,453
  5. Avatar for Steven Pletsch 75. Steven Pletsch Lv 1 6 pts. 11,445
  6. Avatar for altejoh 76. altejoh Lv 1 6 pts. 11,445
  7. Avatar for Simek 77. Simek Lv 1 6 pts. 11,437
  8. Avatar for drumpeter18yrs9yrs 78. drumpeter18yrs9yrs Lv 1 5 pts. 11,433
  9. Avatar for Mike Lewis 79. Mike Lewis Lv 1 5 pts. 11,433
  10. Avatar for alrianne 80. alrianne Lv 1 5 pts. 11,428

Comments


Bruno Kestemont Lv 1

You can only load solutions that you saved on local pc before. Open the 1249, take your solution and save it before to open it in the new puzzle.

Bautho Lv 1

It seems that there are some mismatches with the new density here and some amino acids.
E.g. Lysine 51 looks rather than an Arginine according to the new density

actiasluna Lv 1

When I loaded another player's share (from the old puzzle not a new share) it converted the score to the new puzzle but is using two points above the old (and quite a bit higher) score plus 2 points for the evo. Is this right or an anomaly?

And I could not load my old puzzle best either (after pulling in old puzzle file, was using devprev, and am not now). I will try this evening to go back to devprev and see if I can retrieve the solution (don't have time this morning).

frood66 Lv 1

Thx Bruno…..yep I tried all that already. Does not matter what I share in 1249 - nothing shows in 1274. I think I was devprev then - now I'm main due to the issue with options .txt keeping it's edits.

Susume Lv 1

I was able to load a previous puzzle solution, but I was unable to use a previous puzzle solution as a guide - error is "This guide does not match the current solution."