Placeholder image of a protein
Icon representing a puzzle

1274: Electron Density Reconstruction 1: Round 2

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
August 18, 2016
Expires
Max points
100
Description

This is a followup to Puzzle 1249, with a new density map derived from a Foldit player solution. The solution seems to fit the data, but needs some refinement! Players may load in solutions from Puzzle 1249.



The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for Void Crushers 100 pts. 12,015
  2. Avatar for Go Science 2. Go Science 74 pts. 11,999
  3. Avatar for Contenders 3. Contenders 54 pts. 11,997
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,991
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,984
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 11,974
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 11,923
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,921
  9. Avatar for Deleted group 9. Deleted group pts. 11,445
  10. Avatar for xkcd 10. xkcd 3 pts. 11,404

  1. Avatar for content 171. content Lv 1 1 pt. 9,610

Comments


bkoep Staff Lv 1

The magnitude of the density might have been diminished when we derived this map, so shares are probably not getting the same density bonus that they received in the previous puzzle. In future puzzles, we can take some steps to offset this kind of discrepancy.

bkoep Staff Lv 1

This starting position is the same Foldit solution from Puzzle 1249 that was used to derive this density map.

alwen Lv 1

The high score in our group is 11990 (Susume's fold).

I just loaded her solo shared at 11982 points.

Evo requirement is 13619 points.

…it's possible I won't be able to evo this.

Bruno Kestemont Lv 1

It seems from my team that evolving design evolved from old group solution needs a lot of points to be further evolved by other team member.
Evolving a reset by any player is ok.

Susume Lv 1

My solo on 1274 came from my solo on 1249, so even though it was brought into 1274 as a solo and not as an evo, and has been saved in 1274 and loaded in a new track and saved again before sharing, it is apparently still tainted.