Placeholder image of a protein
Icon representing a puzzle

1274: Electron Density Reconstruction 1: Round 2

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
August 18, 2016
Expires
Max points
100
Description

This is a followup to Puzzle 1249, with a new density map derived from a Foldit player solution. The solution seems to fit the data, but needs some refinement! Players may load in solutions from Puzzle 1249.



The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for Void Crushers 100 pts. 12,015
  2. Avatar for Go Science 2. Go Science 74 pts. 11,999
  3. Avatar for Contenders 3. Contenders 54 pts. 11,997
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,991
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,984
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 11,974
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 11,923
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,921
  9. Avatar for Deleted group 9. Deleted group pts. 11,445
  10. Avatar for xkcd 10. xkcd 3 pts. 11,404

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 74 pts. 11,938
  2. Avatar for pmthomson90 12. pmthomson90 Lv 1 72 pts. 11,923
  3. Avatar for KarenCH 13. KarenCH Lv 1 70 pts. 11,891
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 68 pts. 11,885
  5. Avatar for gitwut 15. gitwut Lv 1 66 pts. 11,885
  6. Avatar for smilingone 16. smilingone Lv 1 64 pts. 11,874
  7. Avatar for LociOiling 17. LociOiling Lv 1 62 pts. 11,872
  8. Avatar for Deleted player 18. Deleted player pts. 11,856
  9. Avatar for Scopper 19. Scopper Lv 1 58 pts. 11,856
  10. Avatar for pvc78 20. pvc78 Lv 1 56 pts. 11,849

Comments


Bruno Kestemont Lv 1

You can only load solutions that you saved on local pc before. Open the 1249, take your solution and save it before to open it in the new puzzle.

Bautho Lv 1

It seems that there are some mismatches with the new density here and some amino acids.
E.g. Lysine 51 looks rather than an Arginine according to the new density

actiasluna Lv 1

When I loaded another player's share (from the old puzzle not a new share) it converted the score to the new puzzle but is using two points above the old (and quite a bit higher) score plus 2 points for the evo. Is this right or an anomaly?

And I could not load my old puzzle best either (after pulling in old puzzle file, was using devprev, and am not now). I will try this evening to go back to devprev and see if I can retrieve the solution (don't have time this morning).

frood66 Lv 1

Thx Bruno…..yep I tried all that already. Does not matter what I share in 1249 - nothing shows in 1274. I think I was devprev then - now I'm main due to the issue with options .txt keeping it's edits.

Susume Lv 1

I was able to load a previous puzzle solution, but I was unable to use a previous puzzle solution as a guide - error is "This guide does not match the current solution."