Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for KarenCH
    1. KarenCH Lv 1
    100 pts. 9,454
  2. Avatar for gitwut 2. gitwut Lv 1 97 pts. 9,440
  3. Avatar for Superphosphate 3. Superphosphate Lv 1 95 pts. 9,437
  4. Avatar for johnmitch 4. johnmitch Lv 1 92 pts. 9,433
  5. Avatar for pmdpmd 5. pmdpmd Lv 1 89 pts. 9,424
  6. Avatar for bertro 6. bertro Lv 1 86 pts. 9,424
  7. Avatar for jermainiac 7. jermainiac Lv 1 83 pts. 9,409
  8. Avatar for reefyrob 8. reefyrob Lv 1 81 pts. 9,394
  9. Avatar for Mike Lewis 9. Mike Lewis Lv 1 78 pts. 9,388
  10. Avatar for pauldunn 10. pauldunn Lv 1 76 pts. 9,388

Comments