Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,459
  2. Avatar for gitwut 2. gitwut Lv 1 86 pts. 9,450
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 74 pts. 9,450
  4. Avatar for lamoille 4. lamoille Lv 1 63 pts. 9,450
  5. Avatar for tokens 5. tokens Lv 1 53 pts. 9,449
  6. Avatar for Vredeman 6. Vredeman Lv 1 44 pts. 9,448
  7. Avatar for georg137 7. georg137 Lv 1 37 pts. 9,448
  8. Avatar for Blipperman 8. Blipperman Lv 1 31 pts. 9,445
  9. Avatar for Skippysk8s 9. Skippysk8s Lv 1 25 pts. 9,443
  10. Avatar for actiasluna 10. actiasluna Lv 1 21 pts. 9,442

Comments