Placeholder image of a protein
Icon representing a puzzle

1277: Unsolved De-novo Freestyle 83: NMR Constraints

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 25, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1268, now with NMR torsion constraints! We have some experimental data from NMR spectroscopy that tells us about some structural propensities of this protein, but we don’t have a way to turn that data into a structure. Here we've included some of these data as torsional constraints, which constrain the backbone φ- and ψ-torsions of each residue. The constraints are reflected in the Backbone subscore; look for residues with with a bad Backbone score to find areas that need improvement! Some of the torsion constraints are suggestive of α-helices and β-sheets, which have been included in the starting structure for your convenience. Players will be able to load in manual saves from Puzzle 1268 and use them as a starting point here.



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 21,921
  2. Avatar for freefolder 12. freefolder 1 pt. 21,275
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 18,050
  4. Avatar for Team China 14. Team China 1 pt. 17,758
  5. Avatar for Skeptics Guide to the Universe 15. Skeptics Guide to the Universe 1 pt. 15,714
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,127
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 0
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 23,897
  2. Avatar for bertro 2. bertro Lv 1 98 pts. 23,828
  3. Avatar for Susume 3. Susume Lv 1 95 pts. 23,702
  4. Avatar for MurloW 4. MurloW Lv 1 92 pts. 23,680
  5. Avatar for Mark- 5. Mark- Lv 1 90 pts. 23,637
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 87 pts. 23,600
  7. Avatar for LociOiling 7. LociOiling Lv 1 85 pts. 23,515
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 82 pts. 23,389
  9. Avatar for KarenCH 9. KarenCH Lv 1 80 pts. 23,361
  10. Avatar for dembones 10. dembones Lv 1 77 pts. 23,325

Comments

Skippysk8s Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.

Susume Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.

tokens Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.