Placeholder image of a protein
Icon representing a puzzle

1277: Unsolved De-novo Freestyle 83: NMR Constraints

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 25, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1268, now with NMR torsion constraints! We have some experimental data from NMR spectroscopy that tells us about some structural propensities of this protein, but we don’t have a way to turn that data into a structure. Here we've included some of these data as torsional constraints, which constrain the backbone φ- and ψ-torsions of each residue. The constraints are reflected in the Backbone subscore; look for residues with with a bad Backbone score to find areas that need improvement! Some of the torsion constraints are suggestive of α-helices and β-sheets, which have been included in the starting structure for your convenience. Players will be able to load in manual saves from Puzzle 1268 and use them as a starting point here.



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups


  1. Avatar for Gargleblasters 100 pts. 23,899
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 23,828
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 23,718
  4. Avatar for Contenders 4. Contenders 36 pts. 23,689
  5. Avatar for Go Science 5. Go Science 24 pts. 23,245
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 23,217
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 23,193
  8. Avatar for SETI.Germany 8. SETI.Germany 6 pts. 22,347
  9. Avatar for Deleted group 9. Deleted group pts. 22,165
  10. Avatar for xkcd 10. xkcd 2 pts. 21,978

  1. Avatar for fishercat 61. fishercat Lv 1 13 pts. 22,209
  2. Avatar for ViJay7019 62. ViJay7019 Lv 1 12 pts. 22,191
  3. Avatar for manu8170 63. manu8170 Lv 1 12 pts. 22,188
  4. Avatar for Deleted player 64. Deleted player pts. 22,186
  5. Avatar for guineapig 65. guineapig Lv 1 11 pts. 22,178
  6. Avatar for drumpeter18yrs9yrs 66. drumpeter18yrs9yrs Lv 1 10 pts. 22,165
  7. Avatar for monkry 67. monkry Lv 1 10 pts. 22,154
  8. Avatar for placid.lion 68. placid.lion Lv 1 10 pts. 22,129
  9. Avatar for WBarme1234 69. WBarme1234 Lv 1 9 pts. 22,100
  10. Avatar for Bletchley Park 70. Bletchley Park Lv 1 9 pts. 22,034

Comments


Skippysk8s Lv 1

I'd love to see a small puzzle with similar playing conditions. My machine is too small to have worked this puzzle and I feel left out of all the fun.
Good luck all
Skippy

Susume Lv 1

If this turns out to be a useful puzzle type (I hope it does!) it would be very helpful to be able to choose which subscore(s) to use for coloring. This is a feature that has been requested before, but I bring it up because it would enhance this puzzle so well.

tokens Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.