Placeholder image of a protein
Icon representing a puzzle

1277: Unsolved De-novo Freestyle 83: NMR Constraints

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 25, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1268, now with NMR torsion constraints! We have some experimental data from NMR spectroscopy that tells us about some structural propensities of this protein, but we don’t have a way to turn that data into a structure. Here we've included some of these data as torsional constraints, which constrain the backbone φ- and ψ-torsions of each residue. The constraints are reflected in the Backbone subscore; look for residues with with a bad Backbone score to find areas that need improvement! Some of the torsion constraints are suggestive of α-helices and β-sheets, which have been included in the starting structure for your convenience. Players will be able to load in manual saves from Puzzle 1268 and use them as a starting point here.



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups


  1. Avatar for Gargleblasters 100 pts. 23,899
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 23,828
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 23,718
  4. Avatar for Contenders 4. Contenders 36 pts. 23,689
  5. Avatar for Go Science 5. Go Science 24 pts. 23,245
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 23,217
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 23,193
  8. Avatar for SETI.Germany 8. SETI.Germany 6 pts. 22,347
  9. Avatar for Deleted group 9. Deleted group pts. 22,165
  10. Avatar for xkcd 10. xkcd 2 pts. 21,978

  1. Avatar for Tac1 141. Tac1 Lv 1 1 pt. 16,612
  2. Avatar for nagistick 142. nagistick Lv 1 1 pt. 16,156
  3. Avatar for Wheeler22 143. Wheeler22 Lv 1 1 pt. 15,843
  4. Avatar for spyro0717 144. spyro0717 Lv 1 1 pt. 15,728
  5. Avatar for deathbat_87 145. deathbat_87 Lv 1 1 pt. 15,714
  6. Avatar for RuneHakubi 146. RuneHakubi Lv 1 1 pt. 15,415
  7. Avatar for Mirgurth 147. Mirgurth Lv 1 1 pt. 15,389
  8. Avatar for DScott 148. DScott Lv 1 1 pt. 15,329
  9. Avatar for bullmoose3 149. bullmoose3 Lv 1 1 pt. 14,703
  10. Avatar for MaxSaddow 150. MaxSaddow Lv 1 1 pt. 14,570

Comments


Skippysk8s Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.

Susume Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.

tokens Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.