Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104
  1. Avatar for Mike Lewis
    1. Mike Lewis Lv 1
    100 pts. 10,045
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 98 pts. 10,028
  3. Avatar for gitwut 3. gitwut Lv 1 96 pts. 10,023
  4. Avatar for frood66 4. frood66 Lv 1 94 pts. 10,010
  5. Avatar for LociOiling 5. LociOiling Lv 1 91 pts. 9,990
  6. Avatar for actiasluna 6. actiasluna Lv 1 89 pts. 9,977
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 87 pts. 9,959
  8. Avatar for KarenCH 8. KarenCH Lv 1 85 pts. 9,943
  9. Avatar for bertro 9. bertro Lv 1 83 pts. 9,943
  10. Avatar for smilingone 10. smilingone Lv 1 81 pts. 9,936

Comments