mirp Lv 1
Unplayable.
1278: Revisiting Puzzle 69: Scorpion Toxin
Closed since over 9 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- August 31, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
