Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104
  1. Avatar for mitarcher 111. mitarcher Lv 1 3 pts. 8,722
  2. Avatar for kvasirthewise 112. kvasirthewise Lv 1 3 pts. 8,710
  3. Avatar for gurch 113. gurch Lv 1 3 pts. 8,702
  4. Avatar for ecali 114. ecali Lv 1 3 pts. 8,683
  5. Avatar for taminnugget 115. taminnugget Lv 1 3 pts. 8,665
  6. Avatar for Simek 116. Simek Lv 1 3 pts. 8,662
  7. Avatar for jebbiek 117. jebbiek Lv 1 2 pts. 8,654
  8. Avatar for navn 118. navn Lv 1 2 pts. 8,651
  9. Avatar for parsnip 119. parsnip Lv 1 2 pts. 8,644
  10. Avatar for cherry39 120. cherry39 Lv 1 2 pts. 8,635

Comments