Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104

  1. Avatar for hpaege 21. hpaege Lv 1 62 pts. 9,868
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 60 pts. 9,867
  3. Avatar for mirp 23. mirp Lv 1 58 pts. 9,863
  4. Avatar for Galaxie 24. Galaxie Lv 1 57 pts. 9,853
  5. Avatar for reefyrob 25. reefyrob Lv 1 56 pts. 9,851
  6. Avatar for Mark- 26. Mark- Lv 1 54 pts. 9,827
  7. Avatar for Norrjane 27. Norrjane Lv 1 53 pts. 9,824
  8. Avatar for tokens 28. tokens Lv 1 51 pts. 9,821
  9. Avatar for joremen 29. joremen Lv 1 50 pts. 9,816
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 49 pts. 9,811

Comments