Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104
  1. Avatar for Blipperman 31. Blipperman Lv 1 47 pts. 9,799
  2. Avatar for nicobul 32. nicobul Lv 1 46 pts. 9,788
  3. Avatar for Satina 33. Satina Lv 1 45 pts. 9,786
  4. Avatar for pauldunn 34. pauldunn Lv 1 44 pts. 9,783
  5. Avatar for Aubade01 35. Aubade01 Lv 1 42 pts. 9,780
  6. Avatar for johnmitch 36. johnmitch Lv 1 41 pts. 9,764
  7. Avatar for g_b 37. g_b Lv 1 40 pts. 9,754
  8. Avatar for christioanchauvin 38. christioanchauvin Lv 1 39 pts. 9,744
  9. Avatar for JayD7217 39. JayD7217 Lv 1 38 pts. 9,741
  10. Avatar for randomlil 40. randomlil Lv 1 37 pts. 9,719

Comments