Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104
  1. Avatar for YeshuaLives 41. YeshuaLives Lv 1 36 pts. 9,703
  2. Avatar for crpainter 42. crpainter Lv 1 35 pts. 9,677
  3. Avatar for Glen B 43. Glen B Lv 1 34 pts. 9,669
  4. Avatar for alwen 44. alwen Lv 1 33 pts. 9,664
  5. Avatar for phi16 45. phi16 Lv 1 32 pts. 9,655
  6. Avatar for kabubi 46. kabubi Lv 1 31 pts. 9,648
  7. Avatar for guineapig 47. guineapig Lv 1 30 pts. 9,645
  8. Avatar for sheerbliss 48. sheerbliss Lv 1 29 pts. 9,641
  9. Avatar for grogar7 49. grogar7 Lv 1 28 pts. 9,640
  10. Avatar for t012 50. t012 Lv 1 28 pts. 9,636

Comments