Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104

  1. Avatar for tomespen 51. tomespen Lv 1 27 pts. 9,621
  2. Avatar for pvc78 52. pvc78 Lv 1 26 pts. 9,617
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 25 pts. 9,614
  4. Avatar for caglar 54. caglar Lv 1 24 pts. 9,600
  5. Avatar for MicElephant 55. MicElephant Lv 1 24 pts. 9,598
  6. Avatar for jobo0502 56. jobo0502 Lv 1 23 pts. 9,594
  7. Avatar for altejoh 57. altejoh Lv 1 22 pts. 9,586
  8. Avatar for BCAA 58. BCAA Lv 1 22 pts. 9,585
  9. Avatar for O Seki To 59. O Seki To Lv 1 21 pts. 9,584
  10. Avatar for alrianne 60. alrianne Lv 1 20 pts. 9,584

Comments