Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104

  1. Avatar for deLaCeiba 61. deLaCeiba Lv 1 20 pts. 9,583
  2. Avatar for Crossed Sticks 62. Crossed Sticks Lv 1 19 pts. 9,570
  3. Avatar for pfirth 63. pfirth Lv 1 18 pts. 9,564
  4. Avatar for stomjoh 64. stomjoh Lv 1 18 pts. 9,560
  5. Avatar for Deleted player 65. Deleted player pts. 9,556
  6. Avatar for smholst 66. smholst Lv 1 17 pts. 9,552
  7. Avatar for Vinara 67. Vinara Lv 1 16 pts. 9,540
  8. Avatar for uihcv 68. uihcv Lv 1 16 pts. 9,531
  9. Avatar for eromana 69. eromana Lv 1 15 pts. 9,522
  10. Avatar for tallguy-13088 70. tallguy-13088 Lv 1 15 pts. 9,517

Comments