Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104
  1. Avatar for hansvandenhof 81. hansvandenhof Lv 1 10 pts. 9,402
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 10 pts. 9,359
  3. Avatar for Jim Fraser 83. Jim Fraser Lv 1 9 pts. 9,321
  4. Avatar for Mike Cassidy 84. Mike Cassidy Lv 1 9 pts. 9,312
  5. Avatar for jermainiac 85. jermainiac Lv 1 9 pts. 9,310
  6. Avatar for carsonfb 86. carsonfb Lv 1 8 pts. 9,280
  7. Avatar for bendbob 87. bendbob Lv 1 8 pts. 9,224
  8. Avatar for JUMELLE54 88. JUMELLE54 Lv 1 8 pts. 9,193
  9. Avatar for johngran 89. johngran Lv 1 7 pts. 9,186
  10. Avatar for froggs554 90. froggs554 Lv 1 7 pts. 9,173

Comments