Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,444
  2. Avatar for xkcd 12. xkcd 1 pt. 9,116
  3. Avatar for freefolder 13. freefolder 1 pt. 9,022
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 8,552
  5. Avatar for Deleted group 15. Deleted group pts. 8,237
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,118
  7. Avatar for Window Group 17. Window Group 1 pt. 5,978
  8. Avatar for test_group1 18. test_group1 1 pt. 2,104

  1. Avatar for fryguy 91. fryguy Lv 1 7 pts. 9,116
  2. Avatar for WBarme1234 92. WBarme1234 Lv 1 7 pts. 9,088
  3. Avatar for weitzen 93. weitzen Lv 1 6 pts. 9,065
  4. Avatar for severin333 94. severin333 Lv 1 6 pts. 9,048
  5. Avatar for dssb 95. dssb Lv 1 6 pts. 9,043
  6. Avatar for fishercat 96. fishercat Lv 1 6 pts. 9,037
  7. Avatar for harvardman 97. harvardman Lv 1 6 pts. 9,024
  8. Avatar for Imeturoran 98. Imeturoran Lv 1 5 pts. 9,022
  9. Avatar for Arne Heessels 99. Arne Heessels Lv 1 5 pts. 8,971
  10. Avatar for TastyMunchies 100. TastyMunchies Lv 1 5 pts. 8,971

Comments


bertro Lv 1

ending of log.txt:

*** STARTING THREAD ActionGlobalMinimize
**
* ENDING THREAD ActionGlobalMinimize
*** STARTING THREAD ActionIdealize
**
* ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
Sending SOPs:

IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run
*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
*** ENDING THREAD ActionIdealize
**
* STARTING THREAD ActionGlobalMinimize
Sending SOPs:

Entering IRC::run
*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run

bertro Lv 1

same thing, no crash info at all.

End of log.txt file:

*** STARTING THREAD ActionIdealize
**
* ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run
Sending SOPs:

*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
*** ENDING THREAD ActionIdealize
**
* STARTING THREAD ActionGlobalMinimize
Entering IRC::run
*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
*** ENDING THREAD ActionIdealize
**
* STARTING THREAD ActionGlobalMinimize
***** ENDING THREAD ActionGlobalMinimize

bkoep Staff Lv 1

We're aware of some crashing problems with the current devprev version. Did you also have problems playing this on the current version of the "main" update group?

frood66 Lv 1

apologies - yes I am on main. I would not be but for the fact there are now issues with editing options.txt. (for mac anyhow)

I can go further - current main is very slow indeed - chat is a disaster area. SO I'll stick to this old main client for now.

Skippysk8s Lv 1

I never took update and stayed on main. my IRC chat mysteriously disconnects at seeming random times (mibbit, which Bertro set up for me). My in game chat never stays connected, so I only use it to share pictures
All I can say is no one take it personally :)

toshiue Lv 1

am on main, crashing as frequently as every 10 minutes, regardless of action. completely un-playable, have not successfully completed any sequence since the crashes began. has been going on for about 16 hours now, since most recent update. am running Win 7, same end of log file as bertro posted, and am getting clusters of such in log file…

*** STARTING THREAD ActionLocalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -0.0834082 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -0.0834082 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -0.0834082 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -0.0834082 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -0.0834082 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -0.0834082 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -0.0834082 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -0.0834082 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -0.0834082 Finite Diff= 9.81513e+10
delta_score: -2.21917e-10
Playing sound: 4
**
* ENDING THREAD ActionLocalMinimize
Tool on_action_complete called
delta_score: 0
Playing sound: 4
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -1.60528 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -1.60528 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -1.60528 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -1.60528 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -1.60528 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -1.60528 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -1.60528 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -1.60528 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -1.60528 Finite Diff= 9.81513e+10
core.optimization.LineMinimizer: Inaccurate G! step= 1.45519e-13 Deriv= -1.60528 Finite Diff= 3.92605e+11
core.optimization.LineMinimizer: Inaccurate G! step= 3.63798e-14 Deriv= -1.60528 Finite Diff= 1.57042e+12
Sending SOPs:

delta_score: 0
Playing sound: 4
*** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
**
* STARTING THREAD ActionLocalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -0.0834082 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -0.0834082 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -0.0834082 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -0.0834082 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -0.0834082 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -0.0834082 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -0.0834082 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -0.0834082 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -0.0834082 Finite Diff= 9.81513e+10
core.optimization.LineMinimizer: Inaccurate G! step= 1.45519e-13 Deriv= -0.0834082 Finite Diff= 106.25
core.optimization.LineMinimizer: Inaccurate G! step= 3.63798e-14 Deriv= -0.0834082 Finite Diff= 160.156
delta_score: 1.40062e-10
Playing sound: 4
***** ENDING THREAD ActionLocalMinimize

toshiue Lv 1

forgot to say, rarely if ever us irc, but haven't seen any group/veteran/general irc traffic posted since the update…