Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583

  1. Avatar for Mike Lewis
    1. Mike Lewis Lv 1
    100 pts. 10,045
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 98 pts. 10,028
  3. Avatar for gitwut 3. gitwut Lv 1 96 pts. 10,023
  4. Avatar for frood66 4. frood66 Lv 1 94 pts. 10,010
  5. Avatar for LociOiling 5. LociOiling Lv 1 91 pts. 9,990
  6. Avatar for actiasluna 6. actiasluna Lv 1 89 pts. 9,977
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 87 pts. 9,959
  8. Avatar for KarenCH 8. KarenCH Lv 1 85 pts. 9,943
  9. Avatar for bertro 9. bertro Lv 1 83 pts. 9,943
  10. Avatar for smilingone 10. smilingone Lv 1 81 pts. 9,936

Comments