Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583
  1. Avatar for Johannes94 141. Johannes94 Lv 1 1 pt. 8,448
  2. Avatar for Wheeler22 142. Wheeler22 Lv 1 1 pt. 8,443
  3. Avatar for paulgene89 143. paulgene89 Lv 1 1 pt. 8,437
  4. Avatar for vizerot 144. vizerot Lv 1 1 pt. 8,430
  5. Avatar for Alistair69 145. Alistair69 Lv 1 1 pt. 8,428
  6. Avatar for mrmojo42 146. mrmojo42 Lv 1 1 pt. 8,413
  7. Avatar for Amphimixus 147. Amphimixus Lv 1 1 pt. 8,408
  8. Avatar for Sci1217 148. Sci1217 Lv 1 1 pt. 8,395
  9. Avatar for DScott 149. DScott Lv 1 1 pt. 8,390
  10. Avatar for polly66017 150. polly66017 Lv 1 1 pt. 8,389

Comments