Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583

  1. Avatar for MadCat08 161. MadCat08 Lv 1 1 pt. 8,311
  2. Avatar for Darkash28 162. Darkash28 Lv 1 1 pt. 8,308
  3. Avatar for Hollinas 163. Hollinas Lv 1 1 pt. 8,298
  4. Avatar for sor2018 164. sor2018 Lv 1 1 pt. 8,287
  5. Avatar for Mirgurth 165. Mirgurth Lv 1 1 pt. 8,279
  6. Avatar for architekt1024 166. architekt1024 Lv 1 1 pt. 8,279
  7. Avatar for Deleted player 167. Deleted player pts. 8,275
  8. Avatar for bergie72 168. bergie72 Lv 1 1 pt. 8,272
  9. Avatar for placid.lion 169. placid.lion Lv 1 1 pt. 8,263
  10. Avatar for Philippe_C 170. Philippe_C Lv 1 1 pt. 8,262

Comments