Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583
  1. Avatar for Scopper 11. Scopper Lv 1 79 pts. 9,936
  2. Avatar for Deleted player 12. Deleted player pts. 9,914
  3. Avatar for pmdpmd 13. pmdpmd Lv 1 75 pts. 9,906
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 73 pts. 9,901
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 72 pts. 9,895
  6. Avatar for Vredeman 16. Vredeman Lv 1 70 pts. 9,889
  7. Avatar for dembones 17. dembones Lv 1 68 pts. 9,887
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 66 pts. 9,886
  9. Avatar for mimi 19. mimi Lv 1 65 pts. 9,886
  10. Avatar for toshiue 20. toshiue Lv 1 63 pts. 9,876

Comments