Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583
  1. Avatar for Museka 71. Museka Lv 1 14 pts. 9,485
  2. Avatar for jamiexq 72. jamiexq Lv 1 14 pts. 9,478
  3. Avatar for diamonddays 73. diamonddays Lv 1 13 pts. 9,469
  4. Avatar for dbuske 74. dbuske Lv 1 13 pts. 9,451
  5. Avatar for Mr_Jolty 75. Mr_Jolty Lv 1 12 pts. 9,444
  6. Avatar for pmthomson90 76. pmthomson90 Lv 1 12 pts. 9,439
  7. Avatar for TomTaylor 77. TomTaylor Lv 1 12 pts. 9,432
  8. Avatar for ViJay7019 78. ViJay7019 Lv 1 11 pts. 9,427
  9. Avatar for NinjaGreg 79. NinjaGreg Lv 1 11 pts. 9,417
  10. Avatar for georg137 80. georg137 Lv 1 10 pts. 9,416

Comments