Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583
  1. Avatar for hansvandenhof 81. hansvandenhof Lv 1 10 pts. 9,402
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 10 pts. 9,359
  3. Avatar for Jim Fraser 83. Jim Fraser Lv 1 9 pts. 9,321
  4. Avatar for Mike Cassidy 84. Mike Cassidy Lv 1 9 pts. 9,312
  5. Avatar for jermainiac 85. jermainiac Lv 1 9 pts. 9,310
  6. Avatar for carsonfb 86. carsonfb Lv 1 8 pts. 9,280
  7. Avatar for bendbob 87. bendbob Lv 1 8 pts. 9,224
  8. Avatar for JUMELLE54 88. JUMELLE54 Lv 1 8 pts. 9,193
  9. Avatar for johngran 89. johngran Lv 1 7 pts. 9,186
  10. Avatar for froggs554 90. froggs554 Lv 1 7 pts. 9,173

Comments