Placeholder image of a protein
Icon representing a puzzle

1278: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 31, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,045
  2. Avatar for Contenders 2. Contenders 74 pts. 10,023
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,992
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,946
  5. Avatar for Go Science 5. Go Science 27 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,906
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,895
  8. Avatar for It's over 9000! 8. It's over 9000! 8 pts. 9,585
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,584
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,583

  1. Avatar for emdee314 181. emdee314 Lv 1 1 pt. 8,131
  2. Avatar for deathbat_87 182. deathbat_87 Lv 1 1 pt. 8,124
  3. Avatar for aspadistra 183. aspadistra Lv 1 1 pt. 8,118
  4. Avatar for sa_simsalabim 184. sa_simsalabim Lv 1 1 pt. 8,113
  5. Avatar for demeter900 185. demeter900 Lv 1 1 pt. 8,103
  6. Avatar for mirjamvandelft 186. mirjamvandelft Lv 1 1 pt. 8,085
  7. Avatar for kierra 187. kierra Lv 1 1 pt. 8,057
  8. Avatar for Sunmurder 188. Sunmurder Lv 1 1 pt. 8,054
  9. Avatar for anhng48 189. anhng48 Lv 1 1 pt. 8,010
  10. Avatar for jbmkfm125 190. jbmkfm125 Lv 1 1 pt. 7,978

Comments


bertro Lv 1

ending of log.txt:

*** STARTING THREAD ActionGlobalMinimize
**
* ENDING THREAD ActionGlobalMinimize
*** STARTING THREAD ActionIdealize
**
* ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
Sending SOPs:

IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run
*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
*** ENDING THREAD ActionIdealize
**
* STARTING THREAD ActionGlobalMinimize
Sending SOPs:

Entering IRC::run
*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run

bertro Lv 1

same thing, no crash info at all.

End of log.txt file:

*** STARTING THREAD ActionIdealize
**
* ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run
Sending SOPs:

*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
*** ENDING THREAD ActionIdealize
**
* STARTING THREAD ActionGlobalMinimize
Entering IRC::run
*** ENDING THREAD ActionGlobalMinimize
**
* STARTING THREAD ActionIdealize
*** ENDING THREAD ActionIdealize
**
* STARTING THREAD ActionGlobalMinimize
***** ENDING THREAD ActionGlobalMinimize

bkoep Staff Lv 1

We're aware of some crashing problems with the current devprev version. Did you also have problems playing this on the current version of the "main" update group?

frood66 Lv 1

apologies - yes I am on main. I would not be but for the fact there are now issues with editing options.txt. (for mac anyhow)

I can go further - current main is very slow indeed - chat is a disaster area. SO I'll stick to this old main client for now.

Skippysk8s Lv 1

I never took update and stayed on main. my IRC chat mysteriously disconnects at seeming random times (mibbit, which Bertro set up for me). My in game chat never stays connected, so I only use it to share pictures
All I can say is no one take it personally :)

toshiue Lv 1

am on main, crashing as frequently as every 10 minutes, regardless of action. completely un-playable, have not successfully completed any sequence since the crashes began. has been going on for about 16 hours now, since most recent update. am running Win 7, same end of log file as bertro posted, and am getting clusters of such in log file…

*** STARTING THREAD ActionLocalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -0.0834082 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -0.0834082 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -0.0834082 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -0.0834082 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -0.0834082 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -0.0834082 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -0.0834082 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -0.0834082 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -0.0834082 Finite Diff= 9.81513e+10
delta_score: -2.21917e-10
Playing sound: 4
**
* ENDING THREAD ActionLocalMinimize
Tool on_action_complete called
delta_score: 0
Playing sound: 4
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -1.60528 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -1.60528 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -1.60528 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -1.60528 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -1.60528 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -1.60528 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -1.60528 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -1.60528 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -1.60528 Finite Diff= 9.81513e+10
core.optimization.LineMinimizer: Inaccurate G! step= 1.45519e-13 Deriv= -1.60528 Finite Diff= 3.92605e+11
core.optimization.LineMinimizer: Inaccurate G! step= 3.63798e-14 Deriv= -1.60528 Finite Diff= 1.57042e+12
Sending SOPs:

delta_score: 0
Playing sound: 4
*** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
**
* STARTING THREAD ActionLocalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -0.0834082 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -0.0834082 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -0.0834082 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -0.0834082 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -0.0834082 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -0.0834082 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -0.0834082 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -0.0834082 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -0.0834082 Finite Diff= 9.81513e+10
core.optimization.LineMinimizer: Inaccurate G! step= 1.45519e-13 Deriv= -0.0834082 Finite Diff= 106.25
core.optimization.LineMinimizer: Inaccurate G! step= 3.63798e-14 Deriv= -0.0834082 Finite Diff= 160.156
delta_score: 1.40062e-10
Playing sound: 4
***** ENDING THREAD ActionLocalMinimize

toshiue Lv 1

forgot to say, rarely if ever us irc, but haven't seen any group/veteran/general irc traffic posted since the update…