Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for Vredeman
    1. Vredeman Lv 1
    100 pts. 9,548
  2. Avatar for Galaxie 2. Galaxie Lv 1 98 pts. 9,522
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 9,520
  4. Avatar for KarenCH 4. KarenCH Lv 1 93 pts. 9,509
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 91 pts. 9,502
  6. Avatar for reefyrob 6. reefyrob Lv 1 89 pts. 9,499
  7. Avatar for dembones 7. dembones Lv 1 86 pts. 9,499
  8. Avatar for gitwut 8. gitwut Lv 1 84 pts. 9,496
  9. Avatar for bertro 9. bertro Lv 1 82 pts. 9,487
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 80 pts. 9,475

Comments