Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,562
  2. Avatar for jermainiac 2. jermainiac Lv 1 87 pts. 9,554
  3. Avatar for lamoille 3. lamoille Lv 1 75 pts. 9,541
  4. Avatar for Vredeman 4. Vredeman Lv 1 64 pts. 9,534
  5. Avatar for phi16 5. phi16 Lv 1 55 pts. 9,533
  6. Avatar for gmn 6. gmn Lv 1 47 pts. 9,533
  7. Avatar for LociOiling 7. LociOiling Lv 1 40 pts. 9,524
  8. Avatar for smilingone 8. smilingone Lv 1 33 pts. 9,523
  9. Avatar for reefyrob 9. reefyrob Lv 1 28 pts. 9,516
  10. Avatar for Hollinas 10. Hollinas Lv 1 23 pts. 9,504

Comments