Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 19 pts. 9,503
  2. Avatar for Paulo Roque 12. Paulo Roque Lv 1 16 pts. 9,503
  3. Avatar for hansvandenhof 13. hansvandenhof Lv 1 13 pts. 9,501
  4. Avatar for gitwut 14. gitwut Lv 1 10 pts. 9,499
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 8 pts. 9,499
  6. Avatar for JayD7217 16. JayD7217 Lv 1 7 pts. 9,492
  7. Avatar for georg137 17. georg137 Lv 1 5 pts. 9,487
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 4 pts. 9,485
  9. Avatar for alwen 19. alwen Lv 1 3 pts. 9,472
  10. Avatar for pauldunn 20. pauldunn Lv 1 2 pts. 9,472

Comments