Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245

  1. Avatar for Tehnologik1 131. Tehnologik1 Lv 1 1 pt. 8,935
  2. Avatar for paulgene89 132. paulgene89 Lv 1 1 pt. 8,931
  3. Avatar for Iron pet 133. Iron pet Lv 1 1 pt. 8,923
  4. Avatar for martinf 134. martinf Lv 1 1 pt. 8,920
  5. Avatar for Inkedhands 135. Inkedhands Lv 1 1 pt. 8,912
  6. Avatar for Mike Cassidy 136. Mike Cassidy Lv 1 1 pt. 8,900
  7. Avatar for kvasirthewise 137. kvasirthewise Lv 1 1 pt. 8,891
  8. Avatar for DScott 138. DScott Lv 1 1 pt. 8,889
  9. Avatar for placid.lion 139. placid.lion Lv 1 1 pt. 8,889
  10. Avatar for shettler 140. shettler Lv 1 1 pt. 8,873

Comments