Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 9,724
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,714
  3. Avatar for Galaxie 3. Galaxie Lv 1 95 pts. 9,667
  4. Avatar for Susume 4. Susume Lv 1 93 pts. 9,657
  5. Avatar for tokens 5. tokens Lv 1 91 pts. 9,657
  6. Avatar for reefyrob 6. reefyrob Lv 1 88 pts. 9,638
  7. Avatar for dembones 7. dembones Lv 1 86 pts. 9,626
  8. Avatar for Mark- 8. Mark- Lv 1 84 pts. 9,614
  9. Avatar for Vredeman 9. Vredeman Lv 1 81 pts. 9,612
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 79 pts. 9,611

Comments