Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746

  1. Avatar for Mike Lewis
    1. Mike Lewis Lv 1
    100 pts. 9,731
  2. Avatar for actiasluna 2. actiasluna Lv 1 88 pts. 9,731
  3. Avatar for tomespen 3. tomespen Lv 1 77 pts. 9,731
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 67 pts. 9,730
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 58 pts. 9,730
  6. Avatar for Superphosphate 6. Superphosphate Lv 1 50 pts. 9,728
  7. Avatar for smholst 7. smholst Lv 1 43 pts. 9,728
  8. Avatar for frood66 8. frood66 Lv 1 37 pts. 9,726
  9. Avatar for LociOiling 9. LociOiling Lv 1 31 pts. 9,716
  10. Avatar for smilingone 10. smilingone Lv 1 26 pts. 9,714

Comments