Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806

  1. Avatar for bertro 11. bertro Lv 1 22 pts. 9,712
  2. Avatar for reefyrob 12. reefyrob Lv 1 19 pts. 9,708
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 15 pts. 9,704
  4. Avatar for Galaxie 14. Galaxie Lv 1 13 pts. 9,682
  5. Avatar for Vredeman 15. Vredeman Lv 1 11 pts. 9,665
  6. Avatar for lamoille 16. lamoille Lv 1 9 pts. 9,647
  7. Avatar for gmn 17. gmn Lv 1 7 pts. 9,647
  8. Avatar for alwen 18. alwen Lv 1 6 pts. 9,644
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 5 pts. 9,640
  10. Avatar for georg137 20. georg137 Lv 1 4 pts. 9,628

Comments