Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 9,724
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,714
  3. Avatar for Galaxie 3. Galaxie Lv 1 95 pts. 9,667
  4. Avatar for Susume 4. Susume Lv 1 93 pts. 9,657
  5. Avatar for tokens 5. tokens Lv 1 91 pts. 9,657
  6. Avatar for reefyrob 6. reefyrob Lv 1 88 pts. 9,638
  7. Avatar for dembones 7. dembones Lv 1 86 pts. 9,626
  8. Avatar for Mark- 8. Mark- Lv 1 84 pts. 9,614
  9. Avatar for Vredeman 9. Vredeman Lv 1 81 pts. 9,612
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 79 pts. 9,611

Comments