Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 9,327
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,233
  3. Avatar for :) 13. :) 1 pt. 9,200
  4. Avatar for freefolder 14. freefolder 1 pt. 9,194
  5. Avatar for JCBio162 15. JCBio162 1 pt. 8,657
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,639
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,483
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,369
  9. Avatar for Firebirds BioChem 19. Firebirds BioChem 1 pt. 7,654

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,589
  2. Avatar for Aubade01 2. Aubade01 Lv 1 98 pts. 9,587
  3. Avatar for Scopper 3. Scopper Lv 1 96 pts. 9,583
  4. Avatar for pmdpmd 4. pmdpmd Lv 1 94 pts. 9,577
  5. Avatar for dembones 5. dembones Lv 1 93 pts. 9,573
  6. Avatar for LociOiling 6. LociOiling Lv 1 91 pts. 9,564
  7. Avatar for g_b 7. g_b Lv 1 89 pts. 9,560
  8. Avatar for JayD7217 8. JayD7217 Lv 1 87 pts. 9,551
  9. Avatar for pauldunn 9. pauldunn Lv 1 85 pts. 9,550
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 83 pts. 9,548

Comments