Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 9,327
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,233
  3. Avatar for :) 13. :) 1 pt. 9,200
  4. Avatar for freefolder 14. freefolder 1 pt. 9,194
  5. Avatar for JCBio162 15. JCBio162 1 pt. 8,657
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,639
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,483
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,369
  9. Avatar for Firebirds BioChem 19. Firebirds BioChem 1 pt. 7,654

  1. Avatar for leehaggis 121. leehaggis Lv 1 4 pts. 8,948
  2. Avatar for Iron pet 122. Iron pet Lv 1 4 pts. 8,938
  3. Avatar for gdnskye 123. gdnskye Lv 1 3 pts. 8,924
  4. Avatar for iceslayer 124. iceslayer Lv 1 3 pts. 8,911
  5. Avatar for ppp6 125. ppp6 Lv 1 3 pts. 8,910
  6. Avatar for jebbiek 126. jebbiek Lv 1 3 pts. 8,909
  7. Avatar for Elviraah 127. Elviraah Lv 1 3 pts. 8,906
  8. Avatar for SPARKY25 128. SPARKY25 Lv 1 3 pts. 8,903
  9. Avatar for Crossed Sticks 129. Crossed Sticks Lv 1 3 pts. 8,899
  10. Avatar for SouperGenious 130. SouperGenious Lv 1 3 pts. 8,896

Comments