Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,327
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,233
  3. Avatar for :) 13. :) 1 pt. 9,200
  4. Avatar for freefolder 14. freefolder 1 pt. 9,194
  5. Avatar for JCBio162 15. JCBio162 1 pt. 8,657
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,639
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,483
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,369
  9. Avatar for Firebirds BioChem 19. Firebirds BioChem 1 pt. 7,654
  1. Avatar for Zenol 221. Zenol Lv 1 1 pt. 7,819
  2. Avatar for myanmccann 222. myanmccann Lv 1 1 pt. 7,798
  3. Avatar for npapscience 223. npapscience Lv 1 1 pt. 7,714
  4. Avatar for alymanbuttler 224. alymanbuttler Lv 1 1 pt. 7,658
  5. Avatar for tburckin 225. tburckin Lv 1 1 pt. 7,654
  6. Avatar for emtonsti 226. emtonsti Lv 1 1 pt. 7,473
  7. Avatar for Virix 227. Virix Lv 1 1 pt. 7,255
  8. Avatar for nachoml 228. nachoml Lv 1 1 pt. 7,063
  9. Avatar for ostrandmadelyng 229. ostrandmadelyng Lv 1 1 pt. 7,040
  10. Avatar for Kwisatz_Haderach 230. Kwisatz_Haderach Lv 1 1 pt. 7,031

Comments