Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,327
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,233
  3. Avatar for :) 13. :) 1 pt. 9,200
  4. Avatar for freefolder 14. freefolder 1 pt. 9,194
  5. Avatar for JCBio162 15. JCBio162 1 pt. 8,657
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,639
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,483
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,369
  9. Avatar for Firebirds BioChem 19. Firebirds BioChem 1 pt. 7,654
  1. Avatar for ChineseDream 231. ChineseDream Lv 1 1 pt. 6,870
  2. Avatar for demeter900 232. demeter900 Lv 1 1 pt. 6,870
  3. Avatar for RopakPanda 233. RopakPanda Lv 1 1 pt. 6,870
  4. Avatar for Alainx277 234. Alainx277 Lv 1 1 pt. 6,870
  5. Avatar for Rafail 235. Rafail Lv 1 1 pt. 6,870
  6. Avatar for Dfend233 236. Dfend233 Lv 1 1 pt. 6,870
  7. Avatar for we646410766 237. we646410766 Lv 1 1 pt. 6,870
  8. Avatar for johnmangala 238. johnmangala Lv 1 1 pt. 6,870
  9. Avatar for Susume 239. Susume Lv 1 1 pt. 6,870
  10. Avatar for RestrictionEndoNykolease 240. RestrictionEndoNykolease Lv 1 1 pt. 6,870

Comments