Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for JayD7217 11. JayD7217 Lv 1 14 pts. 9,555
  2. Avatar for Blipperman 12. Blipperman Lv 1 11 pts. 9,553
  3. Avatar for Mike Lewis 13. Mike Lewis Lv 1 8 pts. 9,549
  4. Avatar for gitwut 14. gitwut Lv 1 6 pts. 9,547
  5. Avatar for Deleted player 15. Deleted player pts. 9,546
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 4 pts. 9,545
  7. Avatar for ManVsYard 17. ManVsYard Lv 1 3 pts. 9,544
  8. Avatar for actiasluna 18. actiasluna Lv 1 2 pts. 9,544
  9. Avatar for mimi 19. mimi Lv 1 2 pts. 9,543
  10. Avatar for smholst 20. smholst Lv 1 1 pt. 9,543

Comments