Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for weitzen 91. weitzen Lv 1 10 pts. 9,176
  2. Avatar for ViJay7019 92. ViJay7019 Lv 1 10 pts. 9,166
  3. Avatar for moep 93. moep Lv 1 10 pts. 9,165
  4. Avatar for Paulo Roque 94. Paulo Roque Lv 1 9 pts. 9,156
  5. Avatar for Alistair69 95. Alistair69 Lv 1 9 pts. 9,143
  6. Avatar for phi16 96. phi16 Lv 1 9 pts. 9,133
  7. Avatar for mniip 97. mniip Lv 1 8 pts. 9,123
  8. Avatar for jamiexq 98. jamiexq Lv 1 8 pts. 9,107
  9. Avatar for georg137 99. georg137 Lv 1 8 pts. 9,100
  10. Avatar for Merf 100. Merf Lv 1 8 pts. 9,098

Comments