Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for hansvandenhof 101. hansvandenhof Lv 1 7 pts. 9,098
  2. Avatar for heyubob 102. heyubob Lv 1 7 pts. 9,082
  3. Avatar for kvasirthewise 103. kvasirthewise Lv 1 7 pts. 9,073
  4. Avatar for Blipperman 104. Blipperman Lv 1 7 pts. 9,065
  5. Avatar for brianjblair 105. brianjblair Lv 1 7 pts. 9,064
  6. Avatar for Norrjane 106. Norrjane Lv 1 6 pts. 9,061
  7. Avatar for leannerikicheever 107. leannerikicheever Lv 1 6 pts. 9,061
  8. Avatar for Jesse Pinkman 108. Jesse Pinkman Lv 1 6 pts. 9,048
  9. Avatar for eromana 109. eromana Lv 1 6 pts. 9,039
  10. Avatar for guineapig 110. guineapig Lv 1 6 pts. 9,034

Comments