Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for DeusRAI 201. DeusRAI Lv 1 1 pt. 8,316
  2. Avatar for Nikopol0710 202. Nikopol0710 Lv 1 1 pt. 8,314
  3. Avatar for thoyt2012 203. thoyt2012 Lv 1 1 pt. 8,300
  4. Avatar for deathbat_87 204. deathbat_87 Lv 1 1 pt. 8,299
  5. Avatar for Fokin Bogdan 205. Fokin Bogdan Lv 1 1 pt. 8,297
  6. Avatar for Deleted player 206. Deleted player pts. 8,281
  7. Avatar for laurendavidsonn09 207. laurendavidsonn09 Lv 1 1 pt. 8,264
  8. Avatar for leovandavart 208. leovandavart Lv 1 1 pt. 8,257
  9. Avatar for mirjamvandelft 209. mirjamvandelft Lv 1 1 pt. 8,255
  10. Avatar for Meian 210. Meian Lv 1 1 pt. 8,254

Comments