Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for Dantoto 211. Dantoto Lv 1 1 pt. 8,249
  2. Avatar for AcidEaterr 212. AcidEaterr Lv 1 1 pt. 8,247
  3. Avatar for mineking 213. mineking Lv 1 1 pt. 8,245
  4. Avatar for Samarth Desai 214. Samarth Desai Lv 1 1 pt. 8,239
  5. Avatar for Manille 215. Manille Lv 1 1 pt. 8,230
  6. Avatar for hredinge 216. hredinge Lv 1 1 pt. 8,219
  7. Avatar for bengrodner 217. bengrodner Lv 1 1 pt. 8,126
  8. Avatar for RossSortore 218. RossSortore Lv 1 1 pt. 8,121
  9. Avatar for p1639hj 219. p1639hj Lv 1 1 pt. 8,113
  10. Avatar for hi2016zzz 220. hi2016zzz Lv 1 1 pt. 8,049

Comments