Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for placid.lion 141. placid.lion Lv 1 2 pts. 8,844
  2. Avatar for pandapharmd 142. pandapharmd Lv 1 2 pts. 8,826
  3. Avatar for NinjaGreg 143. NinjaGreg Lv 1 2 pts. 8,822
  4. Avatar for 01010011111 144. 01010011111 Lv 1 2 pts. 8,819
  5. Avatar for bzipitidoo 145. bzipitidoo Lv 1 2 pts. 8,812
  6. Avatar for roman madala 146. roman madala Lv 1 2 pts. 8,811
  7. Avatar for tweak64 147. tweak64 Lv 1 1 pt. 8,808
  8. Avatar for Ref_Jo 148. Ref_Jo Lv 1 1 pt. 8,803
  9. Avatar for Geyalust 149. Geyalust Lv 1 1 pt. 8,793
  10. Avatar for DScott 150. DScott Lv 1 1 pt. 8,790

Comments