Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for grogar7 81. grogar7 Lv 1 14 pts. 9,225
  2. Avatar for Jim Fraser 82. Jim Fraser Lv 1 14 pts. 9,222
  3. Avatar for MicElephant 83. MicElephant Lv 1 13 pts. 9,221
  4. Avatar for severin333 84. severin333 Lv 1 13 pts. 9,219
  5. Avatar for ManVsYard 85. ManVsYard Lv 1 12 pts. 9,207
  6. Avatar for machinelves 86. machinelves Lv 1 12 pts. 9,200
  7. Avatar for Deleted player 87. Deleted player pts. 9,197
  8. Avatar for Imeturoran 88. Imeturoran Lv 1 11 pts. 9,194
  9. Avatar for Museka 89. Museka Lv 1 11 pts. 9,181
  10. Avatar for johngran 90. johngran Lv 1 11 pts. 9,181

Comments