Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for johngran 91. johngran Lv 1 13 pts. 8,854
  2. Avatar for pmlkjn 92. pmlkjn Lv 1 12 pts. 8,828
  3. Avatar for justjustin 93. justjustin Lv 1 12 pts. 8,827
  4. Avatar for ManVsYard 94. ManVsYard Lv 1 12 pts. 8,825
  5. Avatar for tallguy-13088 95. tallguy-13088 Lv 1 11 pts. 8,777
  6. Avatar for Deleted player 96. Deleted player pts. 8,775
  7. Avatar for stomjoh 97. stomjoh Lv 1 11 pts. 8,768
  8. Avatar for navn 98. navn Lv 1 10 pts. 8,763
  9. Avatar for DotMatrix 99. DotMatrix Lv 1 10 pts. 8,740
  10. Avatar for Jesse Pinkman 100. Jesse Pinkman Lv 1 10 pts. 8,736

Comments