Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for Sadsaq 121. Sadsaq Lv 1 5 pts. 8,488
  2. Avatar for nekij 122. nekij Lv 1 5 pts. 8,459
  3. Avatar for dfinstad 123. dfinstad Lv 1 5 pts. 8,448
  4. Avatar for aendgraend 124. aendgraend Lv 1 5 pts. 8,447
  5. Avatar for mitarcher 125. mitarcher Lv 1 5 pts. 8,436
  6. Avatar for placid.lion 126. placid.lion Lv 1 4 pts. 8,430
  7. Avatar for parsnip 127. parsnip Lv 1 4 pts. 8,422
  8. Avatar for poiuyqwert 128. poiuyqwert Lv 1 4 pts. 8,417
  9. Avatar for leannerikicheever 129. leannerikicheever Lv 1 4 pts. 8,417
  10. Avatar for szymos249 130. szymos249 Lv 1 4 pts. 8,403

Comments