Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for bzipitidoo 131. bzipitidoo Lv 1 4 pts. 8,390
  2. Avatar for georg137 132. georg137 Lv 1 4 pts. 8,357
  3. Avatar for Altercomp 133. Altercomp Lv 1 4 pts. 8,340
  4. Avatar for Hollinas 134. Hollinas Lv 1 3 pts. 8,336
  5. Avatar for franckpirate 135. franckpirate Lv 1 3 pts. 8,298
  6. Avatar for carsonfb 136. carsonfb Lv 1 3 pts. 8,285
  7. Avatar for Inkedhands 137. Inkedhands Lv 1 3 pts. 8,266
  8. Avatar for pizpot 138. pizpot Lv 1 3 pts. 8,264
  9. Avatar for momadoc 139. momadoc Lv 1 3 pts. 8,243
  10. Avatar for veroxdraco 140. veroxdraco Lv 1 3 pts. 8,194

Comments