Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for Archmaster 181. Archmaster Lv 1 1 pt. 7,507
  2. Avatar for Tyssel 182. Tyssel Lv 1 1 pt. 7,504
  3. Avatar for Matheus Romulo de Carvalho Assis 183. Matheus Romulo de Carvalho Assis Lv 1 1 pt. 7,498
  4. Avatar for emdee314 184. emdee314 Lv 1 1 pt. 7,463
  5. Avatar for Tehnologik1 185. Tehnologik1 Lv 1 1 pt. 7,425
  6. Avatar for nvparker 186. nvparker Lv 1 1 pt. 7,424
  7. Avatar for chinche 187. chinche Lv 1 1 pt. 7,411
  8. Avatar for dliu19 188. dliu19 Lv 1 1 pt. 7,406
  9. Avatar for minimajack 189. minimajack Lv 1 1 pt. 7,397
  10. Avatar for mniip 190. mniip Lv 1 1 pt. 7,375

Comments