Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for jhostert 211. jhostert Lv 1 1 pt. 6,619
  2. Avatar for AO91 212. AO91 Lv 1 1 pt. 6,552
  3. Avatar for mightyroy 213. mightyroy Lv 1 1 pt. 6,475
  4. Avatar for rowan.l.c 214. rowan.l.c Lv 1 1 pt. 6,453
  5. Avatar for GreggieG 215. GreggieG Lv 1 1 pt. 6,401
  6. Avatar for LLeo 216. LLeo Lv 1 1 pt. 6,366
  7. Avatar for RyanDekle 217. RyanDekle Lv 1 1 pt. 6,264
  8. Avatar for kjolit09785 218. kjolit09785 Lv 1 1 pt. 6,246
  9. Avatar for naulneyung 219. naulneyung Lv 1 1 pt. 6,220
  10. Avatar for hc820404 220. hc820404 Lv 1 1 pt. 6,185

Comments